Invitrogen™ Human CNNM4 (aa 636-765) Control Fragment Recombinant Protein

Code produit. 30212150

Marque: Invitrogen™ RP91163

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53629 (PA5-53629. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ancient conserved domain containing protein family. Members of this protein family contain a cyclin box motif and have structural similarity to the cyclins. The encoded protein may play a role in metal ion transport. Mutations in this gene are associated with Jalili syndrome which consists of cone-rod dystrophy and amelogenesis imperfecta.

Spécification

• Accession Number: Q6P4Q7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26504
• Name: Human CNNM4 (aa 636-765) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430430O18Rik; Acdp4; ancient conserved domain protein 4; ancient conserved domain-containing protein 4; Cnnm4; cyclin and CBS domain divalent metal cation transport mediator 4; cyclin M4; cyclin-M4; Kiaa1592; mACDP4; metal transporter CNNM4
• Common Name: CNNM4
• Gene Symbol: CNNM4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining