Invitrogen™ Human CNIH1 (aa 81-123) Control Fragment Recombinant Protein

Product Code. 30193691

Brand: Invitrogen™ RP89079

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51718 (PA5-51718. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CNIH is involved in the selective transport and maturation of TGF-alpha family proteins.

Specifications

• Accession Number: O95406
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10175
• Name: Human CNIH1 (aa 81-123) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610007J15; Cnih; CNIH1; CNIH-1; CNIL; Cornichon family AMPA receptor auxiliary protein 1; cornichon homolog; cornichon homolog 1 (Drosophila); cornichon-like isoform 1; hypothetical protein LOC613143; protein cornichon homolog; Protein cornichon homolog 1; T-cell growth-associated molecule 77; TGAM77; UNQ155/PRO181; wu:fc21b06; wu:fi12c05; zgc:112228; zgc:56103
• Common Name: CNIH1
• Gene Symbol: CNIH1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining