Invitrogen™ Human CNDP1 (aa 32-133) Control Fragment Recombinant Protein

Product Code. 30207129

Brand: Invitrogen™ RP89927

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110757 (PA5-110757. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region.

Specifications

• Accession Number: Q96KN2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84735
• Name: Human CNDP1 (aa 32-133) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI746433; beta-Ala-His dipeptidase; carnosinase 1; carnosine dipeptidase 1; carnosine dipeptidase 1 (metallopeptidase M20 family); CN1; CNDP dipeptidase 1; CNDP1; CPGL2; glutamate carboxypeptidase-like protein 2; HsT2308; serum carnosinase; UNQ1915/PRO4380
• Common Name: CNDP1
• Gene Symbol: CNDP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining