Invitrogen™ Human CMYA5 (aa 2859-2937) Control Fragment Recombinant Protein

Product Code. 30205274

Brand: Invitrogen™ RP109385

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139923 (PA5-139923. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPRYD2, also known as Myospryn, was originally identified as the muscle-specific partner of dysbindin and as a Mef-2 target gene. It is a large scaffolding protein localized to the Z-disc/costamere region of striated muscle. SPRYD2 includes a noncanonical tripartite motif (TRIM-like) that lacks the RING domain but consists of a B-box coiled coil (BBC), fibronectin 3 (FN3) repeats, and SPRY domains. SPRYD2 interacts with desmin and calcineurin, and it has been suggested to play a role in the biogenesis of lysosome and negatively regulates slow-fiber-type transformation and skeletal muscle regeneration. SPRYD2 is dysregulated in Duchenne muscular dystrophy.

Specifications

• Accession Number: Q8N3K9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 202333
• Name: Human CMYA5 (aa 2859-2937) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310076E16Rik; 2310076E21Rik; AA420382; AI504003; C5orf10; cardiomyopathy associated 5; cardiomyopathy-associated protein 5; CMYA5; DTNBP2; Dystrobrevin-binding protein 2; genethonin-3; heart and skeletal muscle-specific and sprouty domain-containing; myospryn; SPRY domain-containing protein 2; SPRYD2; sr553; Srfsd; stretch response protein 553; stretch-response protein 553; stretch-responsive fibronectin protein type 3; Tims; TRIM76; TRIM-like protein; tripartite motif-containing 76; tripartite motif-containing protein 76
• Common Name: CMYA5
• Gene Symbol: CMYA5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDVPKQSVLVSKHHLEAAEDTRVKEPLSSAKSNYAQFISNTSASNADKMVSNKEMPKEPEDTYAKGEDFTVTSKPAGLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining