Invitrogen™ Human CMC1 (aa 30-106) Control Fragment Recombinant Protein

Product Code. 30193732

Brand: Invitrogen™ RP100278

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60329 (PA5-60329. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q7Z7K0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 152100
• Name: Human CMC1 (aa 30-106) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010110K16Rik; 2010312P05Rik; AI596001; C3orf68; Cmc1; Cmc1p; COX assembly mitochondrial protein 1; COX assembly mitochondrial protein 1 homolog; COX assembly mitochondrial protein homolog; C-x(9)-C motif containing 1; C x 9 C mitochondrial protein required for full expression of COX 1; C- x 9-C motif containing 1; mitochondrial metallochaperone-like protein
• Common Name: CMC1
• Gene Symbol: CMC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining