Invitrogen™ Human CLUL1 Control Fragment Recombinant Protein

Product Code. 30211187

Brand: Invitrogen™ RP108651

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (24%), Rat (24%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84979 (PA5-84979. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLUL1 is a protein coding gene. Gene ontology (GO) annotation include extracellular space; nucleus.

Specifications

• Accession Number: Q15846
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27098
• Name: Human CLUL1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CLUL1; clusterin like 1; clusterin-like 1 (retinal); clusterin-like protein 1; RA337M; retinal clusterin-like protein; retinal-specific clusterin-like protein
• Common Name: CLUL1
• Gene Symbol: CLUL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HLRNDSNSGNMKPPLLVFIVCLLWLKDSHCAPTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining