Invitrogen™ Human CLUAP1 (aa 208-299) Control Fragment Recombinant Protein

Product Code. 30199067

Brand: Invitrogen™ RP104788

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83710 (PA5-83710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLUAP1 may play a role in cell proliferation or apoptosis.

Specifications

• Accession Number: Q96AJ1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23059
• Name: Human CLUAP1 (aa 208-299) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310030D15Rik; 2610111M03Rik; CFAP22; cilia and flagella associated protein 22; Cluap1; clusterin associated protein 1; clusterin-associated protein 1; FAP22; flagellar associated protein 22, qilin-like protein, homolog; IFT38; KIAA0643; Qilin
• Common Name: CLUAP1
• Gene Symbol: Cluap1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRMEQERFEEAKNTLCLIQNKLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining