Invitrogen™ Human CLTCL1 (aa 1461-1510) Control Fragment Recombinant Protein

Codice prodotto. 30181206

Marca: Invitrogen™ RP98341

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67395 (PA5-67395. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network.

Specifica

• Accession Number: P53675
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8218
• Name: Human CLTCL1 (aa 1461-1510) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CHC22; clathrin heavy chain 2; clathrin heavy chain like 1; clathrin heavy chain on chromosome 22; clathrin, heavy chain-like 1; Clathrin, heavy polypeptide D; clathrin, heavy polypeptide-like 1; CLH22; CLH-22; CLTCL; CLTCL1; CLTD
• Common Name: CLTCL1
• Gene Symbol: CLTCL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSVNEALNHLLTEEEDYQDAMQHAAESRDAELAQKLLQWFLEEGKRECFA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining