Invitrogen™ Human CLPX (aa 353-445) Control Fragment Recombinant Protein

Product Code. 30204440

Brand: Invitrogen™ RP106178

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65501 (PA5-65501. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP-dependent specificity component of the Clp protease. It directs the protease to specific substrates. Can perform chaperone functions in the absence of clpP.

Specifications

• Accession Number: O76031
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10845
• Name: Human CLPX (aa 353-445) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial; AU014732; caseinolytic mitochondrial matrix peptidase chaperone subunit; caseinolytic peptidase X; caseinolytic protease X; CLPX; ClpX caseinolytic peptidase x homolog; ClpX caseinolytic protease x homolog; E330029I21; energy-dependent regulator of proteolysis
• Common Name: CLPX
• Gene Symbol: CLPX
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GIVFLDEVDKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGTPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining