Invitrogen™ Human CLPB (aa 362-453) Control Fragment Recombinant Protein

Product Code. 30194463

Brand: Invitrogen™ RP104140

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64175 (PA5-64175. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.

Specifica

• Accession Number: Q9H078
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 81570
• Name: Human CLPB (aa 362-453) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL118244; ANKCLB; ankyrin-repeat containing bacterial clp fusion; caseinolytic mitochondrial matrix peptidase chaperone subunit B; caseinolytic peptidase B; caseinolytic peptidase B protein homolog; CLPB; ClpB caseinolytic peptidase B; ClpB caseinolytic peptidase B homolog; ClpB caseinolytic peptidase B homolog (E. coli); ClpB homolog, mitochondrial AAA ATPase chaperonin; HSP78; MEGCANN; MGCA7; Skd3; suppressor of K+ transport defect 3; suppressor of potassium transport defect 3; testicular secretory protein Li 11
• Common Name: CLPB
• Gene Symbol: Clpb
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining