Invitrogen™ Human CLN2 (aa 364-460) Control Fragment Recombinant Protein

Produktkode 30198011

missing translation for 'mfr': Invitrogen™ RP95847

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111084 (PA5-111084. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.

Tekniske data

• Accession Number: O14773
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1200
• Name: Human CLN2 (aa 364-460) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cell growth-inhibiting gene 1 protein; ceroid-lipofuscinosis, neuronal 2; CLN 2; CLN2; GIG 1; GIG1; growth-inhibiting protein 1; LPIC; lysosomal pepstatin insensitive protease; lysosomal pepstatin-insensitive protease; MGC21297; SCAR7; TPP 1; TPP I; Tpp1; TPP-1; TPPI; TPP-I; Tripeptidyl aminopeptidase; tripeptidyl peptidase 1; tripeptidyl peptidase I; tripeptidyl peptidase-I; tripeptidyl-peptidase 1; Tripeptidyl-peptidase I; UNQ267/PRO304
• Common Name: CLN2
• Gene Symbol: TPP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GCWSVSGRHQFRPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISGGGFSNVFPRPSYQEEAVTKFLSSSPHLPPSSYFNASGRAYPDVAALSDGYW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining