Invitrogen™ Human CLIP3 (aa 345-432) Control Fragment Recombinant Protein

Product Code. 30180568

Brand: Invitrogen™ RP98966

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140025 (PA5-140025. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Functions as a cytoplasmic linker protein. Involved in TGN-endosome dynamics.

Specifications

• Accession Number: Q96DZ5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25999
• Name: Human CLIP3 (aa 345-432) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500005P14Rik; AI844915; CAP-GLY domain containing linker protein 3; CAP-Gly domain-containing linker protein 3; clip-170 related protein 59 kDa; CLIP-170-related 59 kDa protein; Clip3; CLIPR59; Clipr-59; Cytoplasmic linker protein 170-related 59 kDa protein; restin-like 1; RGD1306245; RSNL1
• Common Name: CLIP3
• Gene Symbol: CLIP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FICPPKQGLFASVSKISKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGDQVLVAGQKQGIV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining