Invitrogen™ Human CLIP2 (aa 317-465) Control Fragment Recombinant Protein

Product Code. 30211731

Brand: Invitrogen™ RP95914

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54205 (PA5-54205. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the family of cytoplasmic linker proteins, which have been proposed to mediate the interaction between specific membranous organelles and microtubules. This protein was found to associate with both microtubules and an organelle called the dendritic lamellar body. This gene is hemizygously deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.

Specifications

• Accession Number: Q9UDT6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7461
• Name: Human CLIP2 (aa 317-465) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B230327O20; CAP-Gly domain containing linker protein 2; CAP-Gly domain-containing linker protein 2; CLIP; Clip1; CLIP-115; Clip2; Cyln2; cytoplasmic linker 2; cytoplasmic linker protein 1, 115 kDa; cytoplasmic linker protein 115; Cytoplasmic linker protein 2; Kiaa0291; mKIAA0291; testicular tissue protein Li 40; WBSCR3; WBSCR4; williams-Beuren syndrome chromosomal region 3 protein; Williams-Beuren syndrome chromosomal region 4 protein; Williams-Beuren syndrome chromosome region 3; Williams-Beuren syndrome chromosome region 4; WSCR3; WSCR4
• Common Name: CLIP2
• Gene Symbol: CLIP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLLVESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLELTTVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining