Invitrogen™ Human CLIP1 (aa 1288-1437) Control Fragment Recombinant Protein

Product Code. 30205190

Brand: Invitrogen™ RP92538

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82930 (PA5-82930. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLIP170 was initially identified as a new type of intermediate filament associated protein that is highly expressed in Reed-Sternberg cells, the tumoral cells diagnostic for Hodgkin's disease. Later experiments showed that it is located at microtubule plus ends and is required for the binding of endocytic carrier vesicles. CLIP170 has also been suggested to act with LIS1, a protein implicated in brain development, to regulate dynein/dynactin binding microtubules. Other studies suggest that CLIP170 can influence the formation of lamellipodia and cell invasion by invasive breast cancer cells by regulating the release of kinesin and IQGAP1 from a complex of those proteins, CLIP170 and Rac1. At least two isoforms of CLIP170 are known to exist.

Specifications

• Accession Number: P30622
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6249
• Name: Human CLIP1 (aa 1288-1437) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110007I12Rik; 4631429H07Rik; AV017631; C81039; CAP-Gly domain containing linker protein 1; CAP-Gly domain-containing linker protein 1; CLIP; Clip 170; Clip1; CLIP170; CLIP-170; Clip50; Cyln1; cytoplasmic linker protein 1; Cytoplasmic linker protein 170; Cytoplasmic linker protein 170 alpha-2; cytoplasmic linker protein 50; cytoplasmic linker protein CLIP-170; Kiaa4046; MGC131604; mKIAA4046; Reed-Steinberg cell-espressed intermediate filament-associated protein; Reed-Sternberg intermediate filament-associated protein; Restin; restin (Reed-Steinberg cell-espressed intermediate filament-associated protein); restin (Reed-Steinberg cell-expressed intermediate filament-associated protein); Rsn
• Common Name: CLIP1
• Gene Symbol: CLIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining