Invitrogen™ Human CLIF (aa 465-526) Control Fragment Recombinant Protein

Product Code. 30209958

Brand: Invitrogen™ RP105354

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84690 (PA5-84690. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a basic helix-loop-helix transcription factor belonging to the PAS (PER, ARNT, SIM) superfamily. The PAS proteins play important roles in adaptation to low atmospheric and cellular oxygen levels, exposure to certain environmental pollutants, and diurnal oscillations in light and temperature. This protein forms a transcriptionally active heterodimer with the circadian CLOCK protein, the structurally related MOP4, and hypoxia-inducible factors, such as HIF1alpha. Consistent with its role as a biologically relevant partner of circadian and hypoxia factors, this protein is coexpressed in regions of the brain such as the thalamus, hypothalamus, and amygdala. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011].

Specifications

• Accession Number: Q8WYA1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56938
• Name: Human CLIF (aa 465-526) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4632430A05Rik; Arnt4; Arntl2; aryl hydrocarbon receptor nuclear translocator like 2; aryl hydrocarbon receptor nuclear translocator-like 2; aryl hydrocarbon receptor nuclear translocator-like protein 2; Basic-helix-loop-helix-PAS protein MOP9; BHLHE6; BMAL2; brain and muscle ARNT-like 2; brain and muscle Arnt-like protein 2 variant d; brain-muscle-ARNT-like protein 2; class E basic helix-loop-helix protein 6; CLIF; CYCLE-like factor; member of PAS protein 9; MGC149671; MGC149672; MOP9; PAS domain-containing protein 9; PASD9; transcription factor BMAL2
• Common Name: CLIF
• Gene Symbol: ARNTL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining