Invitrogen™ Human CLEC4E (aa 90-204) Control Fragment Recombinant Protein

Artikelnummer.	Quantity	unitSize
30194999	100 μL	100µL

Artikelnummer. 30194999

Marke: Invitrogen™ RP88577

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52135 (PA5-52135. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLEC4E encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.

Spezifikation

• Accession Number: Q9ULY5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26253
• Name: Human CLEC4E (aa 90-204) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C86253; CLEC4E; CLECSF9; C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 9; C-type lectin domain family 4 member E; C-type lectin domain family 4, member E; C-type lectin superfamily member 9; C-type lectin, superfamily member 9; immunoreceptor; macrophage-inducible C-type lectin; Mincle; UNQ218/PRO244
• Common Name: CLEC4E
• Gene Symbol: CLEC4E
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining