Invitrogen™ Human CLEC3A (aa 94-156) Control Fragment Recombinant Protein

Product Code. 30211346

Brand: Invitrogen™ RP101442

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62424 (PA5-62424. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLEC3A gene ontology annotations related to this gene include carbohydrate binding.

Specifications

• Accession Number: O75596
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10143
• Name: Human CLEC3A (aa 94-156) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110019O10Rik; Cartilage-derived C-type lectin; clec3a; CLECSF1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 1 (cartilage-derived); C-type calcium dependent, carbohydrate-recognition domain lectin, superfamily member 1, cartilage-derived; C-type lectin domain family 3 member A; C-type lectin domain family 3, member a; C-type lectin homolog precursor; C-type lectin superfamily member 1; domain) lectin, superfamily member 1(cartilage-derived); Gm796; UNQ700/PRO1345
• Common Name: CLEC3A
• Gene Symbol: CLEC3A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining