Invitrogen™ Human CLEC2D (aa 60-160) Control Fragment Recombinant Protein

Product Code. 30211551

Brand: Invitrogen™ RP89969

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53617 (PA5-53617. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Recently, Zhou et al have identified a protein that can inhibit multinucleate Osteoclast formation in murine osteoblast and spleen cell co-cultures. This protein called, Osteoclast Inhibitory Lectin (OCIL) can also inhibit osteoclast formation in spleen cell cultures treated with RANKL and M-CSF. Furthermore, mOCIL acted directly on macrophage/monocyte cells as evidenced by its inhibitory action on adherent spleen cell cultures, which were depleted of stromal and lymphocytic cells. mOCIL completely inhibited osteoclast formation during the proliferative phase of osteoclast formation and resulted in 70% inhibition during the differentiation phase. Osteoblast OCIL mRNA expression was enhanced by parathyroid hormone, calcitriol, interleukin-1 and IL-11, and retinoic acid. OCIL is expressed in osteoblasts and chondrocytes as well as in a variety of extraskeletal tissues. Since OCIL expression was found to be very similar to distribution for RANKL, it has been suggested that RANKl and OCIL may interact in skeleton and in extracellular tissues.

Specifications

• Accession Number: Q9UHP7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29121
• Name: Human CLEC2D (aa 60-160) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CLAX; Clec2d; Clrb; Clr-b; C-type lectin domain family 2 member D; C-type lectin domain family 2, member d; C-type lectin related f; C-type lectin superfamily 2, member D; C-type lectin-domain family 2 member D; C-type lectin-related protein B; lectin-like NK cell receptor; Lectin-like transcript 1; lectin-like transmembrane protein; LLT1; LLT-1; MGC123478; OCIL; Osteoclast inhibitory lectin
• Common Name: CLEC2D
• Gene Symbol: CLEC2D
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining