Invitrogen™ Human CLEC14A (aa 142-213) Control Fragment Recombinant Protein

Product Code. 30198659

Brand: Invitrogen™ RP106173

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111267 (PA5-111267. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLEC-14A (C-type lectin domain family 14 member A), also known as EGFR-5 (epidermal growth factor receptor 5) or CEG1, is a 490 amino acid single-pass type I membrane protein that contains one C-type lectin domain and an EGF-like domain. The gene encoding CLEC-14A maps to human chromosome 14, which houses over 700 genes and comprises nearly 3.5% of the human genome. Chromosome 14 encodes the presinilin 1 (PSEN1) gene, which is one of the three key genes associated with the development of Alzheimer's disease (AD). The SERPINA1 gene is also located on chromosome 14 and, when defective, leads to the genetic disorder alpha1-antitrypsin deficiency, which is characterized by severe lung complications and liver dysfunction.

Specifications

• Accession Number: Q86T13
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 161198
• Name: Human CLEC14A (aa 142-213) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200003C23Rik; AI642649; C14orf27; CEG1; Clec14a; ClECT and EGF-like domain containing protein; C-type lectin domain family 14 member A; C-type lectin domain family 14, member A; EGFR5; EGFR-5; Epidermal growth factor receptor 5; RGD1306232; UNQ236/PRO269
• Common Name: CLEC14A
• Gene Symbol: CLEC14A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RCAVLQATGGVEPAGWKEMRCHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGTEVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining