Invitrogen™ Human CLCN7 (aa 706-783) Control Fragment Recombinant Protein

Product Code. 30182777

Brand: Invitrogen™ RP98666

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60426 (PA5-60426. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene belongs to the CLC chloride channel family of proteins. Chloride channels play important roles in the plasma membrane and in intracellular organelles. This gene encodes chloride channel 7. Defects in this gene are the cause of osteopetrosis autosomal recessive type 4 (OPTB4), also called infantile malignant osteopetrosis type 2 as well as the cause of autosomal dominant osteopetrosis type 2 (OPTA2), also called autosomal dominant Albers-Schonberg disease or marble disease autosoml dominant. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. OPTA2 is the most common form of osteopetrosis, occurring in adolescence or adulthood.

Specifications

• Accession Number: P51798
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1186
• Name: Human CLCN7 (aa 706-783) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA409691; AW538136; chloride channel 7; chloride channel 7 alpha subunit; Chloride channel protein 7; chloride channel, voltage-sensitive 7; chloride voltage-gated channel 7; CLC7; CLC-7; CLCN7; CLCN-7; D17Wsu51e; H(+)/Cl(-) exchange transporter 7; OPTA2; OPTB4; PPP1R63; protein phosphatase 1, regulatory subunit 63
• Common Name: CLCN7
• Gene Symbol: CLCN7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining