Invitrogen™ Human CLCN6 (aa 573-666) Control Fragment Recombinant Protein

Product Code. 30198392

Brand: Invitrogen™ RP95552

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56927 (PA5-56927. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the voltage-dependent chloride channel protein family. Members of this family can function as either chloride channels or antiporters. This protein is primarily localized to late endosomes and functions as a chloride/proton antiporter. Alternate splicing results in both coding and non-coding variants. Additional alternately spliced variants have been described but their full-length structure is unknown. [provided by RefSeq, Mar 2012].

Specifications

• Accession Number: P51797
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1185
• Name: Human CLCN6 (aa 573-666) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI850629; chloride channel 6; chloride channel protein 6; chloride channel, voltage-sensitive 6; chloride transport protein 6; chloride voltage-gated channel 6; Clc6; CLC-6; ClC-6 d; CLCN6; D1-A2; KIAA0046
• Common Name: CLCN6
• Gene Symbol: CLCN6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGIYDIHVGLRGVPLLEWETEVEMDKLRASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFKKSSILT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining