Invitrogen™ Human CLCN4 (aa 637-700) Control Fragment Recombinant Protein

Product Code. 30199682

Brand: Invitrogen™ RP95429

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56702 (PA5-56702. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The family of voltage-dependent chloride channels (CLCs) regulate cellular trafficking of chloride ions, a critical component of all living cells. CLCs regulate excitability in muscle and nerve cells, aid in organic solute transport and maintain cellular volume. The genes encoding human CLC-1 through CLC-7 map to chromosomes 7, 3q26, 4q32, Xp22, Xp11, 1p36 and 16p13, respectively. CLC-1 is highly expressed in skeletal muscle. Mutations in the gene encoding CLC-1 lead to myotonia, an inheritable disorder characterized by muscle stiffness and renal salt wasting. CLC-2 is highly expressed in the epithelia of several organs including lung, which suggests CLC-2 may be a possible therapeutic target for cystic fibrosis. CLC-3 expression is particularly abundant in neuronal tissue, while CLC-4 expression is evident in skeletal and cardiac muscle as well as brain.

Specifications

• Accession Number: P51793
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1183
• Name: Human CLCN4 (aa 637-700) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: chloride channel 4; chloride channel 4-2; chloride channel protein 4; chloride channel, voltage-sensitive 4; chloride transporter ClC-4; chloride voltage-gated channel 4; CLC 4; CLC4; clC-4; Clc4-2; ClC-4 A; CLCN4; Clcn4-2; H(+)/Cl(-) exchange transporter 4; MGC163150; putative chloride channel (similar to Mm Clcn4-2); putative chloride channel 4-2
• Common Name: CLCN4
• Gene Symbol: CLCN4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining