Invitrogen™ Human Claudin 16 (aa 189-235) Control Fragment Recombinant Protein

Product Code. 30199316

Brand: Invitrogen™ RP103241

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tight junction group of proteins are a cell-to-cell adhesion structure in epithelial cells that constitute the epithelial junctional complex with adherens junctions and desmosomes. Tight junction strands are mainly composed of claudins, occludin, and JAM. Claudin-16 belongs to the Claudin family of protein which is composed of 23 integral membrane proteins. Claudins are responsible for the formation of tight junction strands and are connected with the actin cytoskeleton mediated by ZO-1. Claudin 16, also known as Paracellin-1, is a renal tight junction protein required for paracellular magnesium resorption. It is localized in the intercellular junctions of the epithelial cells of the thick ascending limb of Henle's loop (a TAL marker) are used to localize this specific structure of nephrons in kidney sections. Mg2+ resorption occurs in TAL, and Claudin-16 is required for this paracellular function. Failure in renal 'handling' of magnesium can result in hypermagnesemia, whose major direct toxicity implications are cardiovascular as well as renal failure. Recent studies have shown that the lack of Claudin-16 proteins contributes to the dysfunction of paracellular renal transport systems.

Specifications

• Accession Number: Q9Y5I7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10686
• Name: Human Claudin 16 (aa 189-235) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: claudin 16; claudin-16; claudin-16; LOW QUALITY PROTEIN: claudin-16; CLDN16; H59D2a protein; HOMG3; hypomagnesemia 3, with hypercalciuria and nephrocalcinosis; paracellin-1; PCLN1; PCLN-1
• Common Name: Claudin 16
• Gene Symbol: CLDN16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining