Invitrogen™ Human Claudin 10 (aa 183-213) Control Fragment Recombinant Protein

Codice prodotto. 30196779

missing translation for 'mfr': Invitrogen™ RP102925

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Claudin proteins are a family of proteins associated with tight junctions. Tight junctions are specialized regions of cell to cell contact; made up of network of strands to act as a molecular gasket for preventing the leakage of ions, water etc. between cells. They are abundant in luminal epithelial sheets where they maintain epithelial cell polarity. Different tissues exhibit different Claudin composition.

Specifica

• Accession Number: P78369
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9071
• Name: Human Claudin 10 (aa 183-213) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6720456I16Rik; claudin 10; claudin 10 A; claudin 10 B; claudin-10; claudin-10 A; Cldn10; Cldn10a; Cldn10b; CPETRL3; D14Ertd728e; Oligodendrocyte-specific protein-like; OSP-L; OSP-like; OSP-like protein
• Common Name: Claudin 10
• Gene Symbol: Cldn10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ISDNNKTPRYTYNGATSVMSSRTKYHGGEDF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining