Invitrogen™ Human CLASP1 (aa 1112-1170) Control Fragment Recombinant Protein

Product Code. 30194184

Brand: Invitrogen™ RP103589

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64205 (PA5-64205. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs.

Specifications

• Accession Number: Q7Z460
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23332
• Name: Human CLASP1 (aa 1112-1170) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700030C23Rik; 5730583A19Rik; B130045P17Rik; CLASP1; CLASP1alpha; CLIP associating protein 1; CLIP-associating protein 1; cytoplasmic linker associated protein 1; cytoplasmic linker-associated protein 1; hOrbit1; Kiaa0622; MAST1; multiple asters 1; multiple asters homolog 1; Protein Orbit homolog 1
• Common Name: CLASP1
• Gene Symbol: CLASP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TSPTNCSHGGLSPSRLWGWSADGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining