Invitrogen™ Human CKMT2 (aa 2-57) Control Fragment Recombinant Protein

Product Code. 30196789

Brand: Invitrogen™ RP101289

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111344 (PA5-111344. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: P17540
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1160
• Name: Human CKMT2 (aa 2-57) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2300008A19Rik; basic-type mitochondrial creatine kinase; CKMT2; Creatine kinase S-type, mitochondrial; creatine kinase, mitochondrial 2; creatine kinase, mitochondrial 2 (sarcomeric); creatine kinase, mitochondrial 2, sarcomeric; EC 2.7.3.2; mib-CK; sarcomeric mitochondrial creatine kinase; ScCKmit; SMTCK; S-MtCK
• Common Name: CKMT2
• Gene Symbol: Ckmt2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining