Invitrogen™ Human CKAP2 (aa 461-575) Control Fragment Recombinant Protein

Product Code. 30202586

Brand: Invitrogen™ RP89674

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55703 (PA5-55703. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nedd4-binding partner-1 (N4BP1) is a developmentally expressed protein interactor and monoubiquitylation substrate of Nedd4, a HECT domain-containing ubiquitin ligase that mediates ubiquitylation and proteasome degradation of target proteins and may have a fundamental role to play in embryonic processes. N4BP1 can undergo Nedd4-mediated polyubiquitylation and proteosomal degradation. N4BP1 also functions as a negative regulator of AIF4 (also known as ITCH or Atrophin-1), an E3-ubiquitin ligase, by interacting with the second WW domain of AIF4 and impairing ubiquitination of substrates.

Specifications

• Accession Number: Q8WWK9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26586
• Name: Human CKAP2 (aa 461-575) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI461656; AW228814; Ckap2; CTCL tumor antigen se20-10; cytoskeleton associated protein 2; cytoskeleton-associated protein 2; LB1; se20-10; TMAP; Tumor- and microtubule-associated protein; tumor-associated microtubule-associated protein
• Common Name: CKAP2
• Gene Symbol: CKAP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VKYWICLALIEPITSPIENIIAIYEKAILAGAQPIEEMRHTIVDILTMKSQEKANLGENMEKSCASKEEVKEVSIEDTGVDVDPEKLEMESKLHRNLLFQDCEKEQDNKTKDPTH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining