Invitrogen™ Human CIZ1 (aa 477-553) Control Fragment Recombinant Protein

Product Code. 30211687

Brand: Invitrogen™ RP93010

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54193 (PA5-54193. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May regulate the subcellular localization of CIP/WAF1.

Specifications

• Accession Number: Q9ULV3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25792
• Name: Human CIZ1 (aa 477-553) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610038H21Rik; 2900056O04Rik; CDKN1A interacting zinc finger protein 1; CDKN1A-interacting zinc finger protein 1; Cip1-interacting zinc finger protein; CIZ1; LSFR1; NP94; nuclear protein NP94; Zinc finger protein 356; ZNF356
• Common Name: CIZ1
• Gene Symbol: CIZ1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining