Invitrogen™ Human CIR1 (aa 277-356) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30193779	100 μL	100µL

Product Code. 30193779 Supplier Invitrogen™ Supplier No. RP108457

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111523 (PA5-111523. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CIR1 is a protein coding gene.

Specifications

• Accession Number: Q86X95
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9541
• Name: Human CIR1 (aa 277-356) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700023b02rik; 2810021A19Rik; CBF1 (RBPJ) interacting corepressor 1; CBF1 interacting corepressor; CBF1-interacting corepressor; Cicr; Cir; CIR1; Corepressor interacting with RBPJ 1; corepressor interacting with RBPJ, 1; corepressor interacting with RBPJ, CIR1; recepin; RGD1309199
• Common Name: CIR1
• Gene Symbol: CIR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining