missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CIB4 (aa 96-185) Control Fragment Recombinant Protein

Product Code. 30208366
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208366

Brand: Invitrogen™ RP96159

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57532 (PA5-57532. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CIB4 (calcium and integrin-binding family member 4) is a 185 amino acid protein that contains three EF-hand domains. CIB4 is closely related to CIB (CIB has one less EF-hand domain), which is known to bind to Integrin alpha II beta in platelets and is involved in signal transduction. The gene encoding CIB4 maps to human chromosome 2, which houses over 1,400 genes and comprises nearly 8% of the human genome. Harlequin icthyosis, a rare and morbid skin deformity, is associated with mutations in the ABCA12 gene, while the lipid metabolic disorders itosterolemia is associated with defects in the ABCG5 and ABCG8 genes. Additionally, an extremely rare recessive genetic disorder, Alstrom syndrome, is caused by mutationsin the ALMS1 gene, which maps to chromosome 2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number A0PJX0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 130106
Name Human CIB4 (aa 96-185) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700041E20Rik; calcium and integrin binding family member 4; calcium and integrin-binding family member 4; Cib4; KIP4
Common Name CIB4
Gene Symbol Cib4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.