Invitrogen™ Human CIB3 (aa 13-104) Control Fragment Recombinant Protein

Product Code. 30208924

Brand: Invitrogen™ RP108849

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product shares a high degree of sequence similarity with DNA-dependent protein kinase catalytic subunit-interacting protein 2 in human and mouse, and like them may bind the catalytic subunit of DNA-dependent protein kinases. The exact function of this gene is not known. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q96Q77
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 117286
• Name: Human CIB3 (aa 13-104) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C730014M21Rik; calcium and integrin binding family member 3; calcium and integrin-binding family member 3; CIB3; DNA-dependent protein kinase catalytic subunit-interacting protein 3; Gm1107; Kinase-interacting protein 3; KIP 3; KIP3
• Common Name: CIB3
• Gene Symbol: CIB3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining