missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204156

Invitrogen™ Human cIAP1 (aa 92-209) Control Fragment Recombinant Protein

Product Code. 30204156
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204156

Brand: Invitrogen™ RP101866

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82193 (PA5-82193. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded protein inhibits apoptosis induced by serum deprivation and menadione, a potent inducer of free radicals.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13490
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 329
Name Human cIAP1 (aa 92-209) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Api1; Api2; apoptosis inhibitor 1; apoptosis inhibitor 2; AW146227; baculoviral IAP repeat containing 2; baculoviral IAP repeat-containing 2; baculoviral IAP repeat-containing 3; baculoviral IAP repeat-containing protein 2; baculoviral IAP repeat-containing protein 2; putative inhibitor of apoptosis; BIRC2; Birc3; cellular inhibitor of apoptosis 1; cIAP1; C-IAP1; cIAP2; HIAP1; HIAP2; Hiap-2; IAP homolog B; IAP1; IAP2; IAP-2; inhibitor of apoptosis protein; inhibitor of apoptosis protein 2; LOC100622859; mcIAP1; MIAP1; MIAP2; mIAP-2; MIHB; MIHC; NFR2-TRAF signalling complex protein; rIAP1; RING finger protein 48; RING-type E3 ubiquitin transferase BIRC2; RNF48; TNFR2-TRAF-signaling complex protein 2
Common Name cIAP1
Gene Symbol BIRC2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.