Invitrogen™ Human CHSY3 (aa 654-724) Control Fragment Recombinant Protein

Artikelnummer. 30194374

missing translation for 'mfr': Invitrogen™ RP96969

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60777 (PA5-60777. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Has both beta-1,3-glucuronic acid and beta-1,4-N-acetylgalactosamine transferase activity. Transfers glucuronic acid (GlcUA) from UDP-GlcUA and N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of the elongating chondroitin polymer. Specific activity is much reduced compared to CHSY1.

Spezifikation

• Accession Number: Q70JA7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 337876
• Name: Human CHSY3 (aa 654-724) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4833446K15Rik; AI662215; carbohydrate synthase 2; Chondroitin glucuronyltransferase 3; chondroitin sulfate synthase 3; Chondroitin synthase 2; chondroitin synthase-2; Chsy2; chSy-2; Chsy3; Css3; Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase II; Kiaa4168; N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 3; N-acetylgalactosaminyltransferase 3; RGD1560819
• Common Name: CHSY3
• Gene Symbol: CHSY3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining