Invitrogen™ Human CHST9 (aa 40-172) Control Fragment Recombinant Protein

Product Code. 30201020

Brand: Invitrogen™ RP90373

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52828 (PA5-52828. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST9, carry out sulfation of carbohydrates (Hiraoka et al., 2001 ).

Specifications

• Accession Number: Q7L1S5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83539
• Name: Human CHST9 (aa 40-172) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430438D01Rik; carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 9; carbohydrate sulfotransferase 9; CHST9; GalNAc-4-O-sulfotransferase 2; GalNAc4ST2; galNAc-4-ST2; GalNAc4ST-2; GalNAc-4-sulfotransferase 2; N-acetylgalactosamine 4-O-sulfotransferase 2; N-acetylgalactosamine-4-O-sulfotransferase 2; UNQ2549/PRO6175
• Common Name: CHST9
• Gene Symbol: CHST9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TGRVEKRREQKVTSGWGPVKYLRPVPRIMSTEKIQEHITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQALSKSTGSPTEKLIEKRQGAKTVFNKFSNMNWPVDIHPLNKSLVKDNKWKKTE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining