Invitrogen™ Human CHST3 (aa 44-94) Control Fragment Recombinant Protein

Product Code. 30207536

missing translation for 'mfr': Invitrogen™ RP100930

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65472 (PA5-65472, PA5-63163 (PA5-63163. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHST3 is an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrixand most cells which is involved in cell migration and differentiation.

Specifications

• Accession Number: Q7LGC8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9469
• Name: Human CHST3 (aa 44-94) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C6ST; C6ST1; C6ST-1; carbohydrate (chondroitin 6) sulfotransferase 3; carbohydrate (chondroitin 6/keratan) sulfotransferase 3; carbohydrate sulfotransferase 3; chondroitin 6 sulfotransferase 1; chondroitin 6-O-sulfotransferase 1; Chondroitin 6-sulfotransferase; chondroitin 6-sulfotransferase 3; Chst3; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0; GST; Gst0; GST-0; HSD
• Common Name: CHST3
• Gene Symbol: Chst3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining