Invitrogen™ Human Chromogranin B (aa 272-406) Control Fragment Recombinant Protein

Product Code. 30207732

Brand: Invitrogen™ RP89889

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52954 (PA5-52954. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Chromogranin B is a tyrosine sulfated secretory protein found in a wide variety of peptidergic endocrine cells. Chromogranin functions as a neuroendocrine secretory granule protein which may be the precursor for other biologically active peptides.

Specifications

• Accession Number: P05060
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1114
• Name: Human Chromogranin B (aa 272-406) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CCB peptide; CCB peptide long form; CCB peptide short form; CgB; CHGB; chromogranin B; chromogranin B (secretogranin 1); Chromogranin B, parathyroid secretory protein; chromogranin-B; GAWK peptide; Glucagonoma peptide; PE-11; SCG1; Scg-1; secretogranin B; secretogranin I; Secretogranin-1; secretogranin-I; SgI
• Common Name: Chromogranin B
• Gene Symbol: Chgb
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SEVDKRRTRPRHHHGRSRPDRSSQGGSLPSEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining