Invitrogen™ Human CHRAC1 (aa 1-56) Control Fragment Recombinant Protein

Product Code. 30209987

Brand: Invitrogen™ RP106907

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84398 (PA5-84398. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004].

Specifications

• Accession Number: Q9NRG0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54108
• Name: Human CHRAC1 (aa 1-56) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410152E03Rik; 2810406L04Rik; CHARC1; CHARC15; CHRAC1; CHRAC-1; CHRAC15; CHRAC-15; CHRC1; chromatin accessibility complex 1; chromatin accessibility complex 15 kDa protein; Chromatin accessibility complex protein 1; DNA polymerase epsilon subunit p15; histone-fold protein CHRAC15; HuCHRAC15; NF-YC-like protein; YCL1; YC-like protein 1
• Common Name: CHRAC1
• Gene Symbol: CHRAC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining