Invitrogen™ Human CHP1 (aa 22-148) Control Fragment Recombinant Protein

Product Code. 30195215

Brand: Invitrogen™ RP89506

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82255 (PA5-82255. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulates centrosome duplication, probably by inhibiting the kinase activity of ROCK2. Proposed to act as co-chaperone for HSP90. May play a role in the regulation of NOD1 via a HSP90 chaperone complex. In vitro, has intrinsic chaperone activity. This function may be achieved by inhibiting association of ROCK2 with NPM1. Involved in stress response. Prevents tumorigenesis.

Specifications

• Accession Number: Q99653
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11261
• Name: Human CHP1 (aa 22-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500003O03Rik; AA960066; AI046351; Cahp; calcineurin B homolog; calcineurin B homologous protein 1; Calcineurin B-like protein; calcineurin homologous protein; calcineurin like EF-hand protein 1; calcineurin-like EF hand protein 1; calcineurin-like EF-hand protein 1; calcium binding protein P22; calcium-binding protein CHP; Calcium-binding protein p22; CHP; chp1; Chromo domain-containing protein 1; chromodomain protein Chp1; EF-hand Ca2+-binding protein p22; EF-hand calcium-binding domain-containing protein p22; p22; p24; si:dkey-41n20.1; sid 470; Sid470; Sid470p; SLC9A1 binding protein; SLC9A1BP; SPAC18G6.02 c; Unknown (protein for MGC:127971); Unknown (protein for MGC:63904); vac; Wrch2; wu:fc69b04; zgc:63904
• Common Name: CHP1
• Gene Symbol: CHP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNIS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining