Invitrogen™ Human CHORDC1 (aa 37-106) Control Fragment Recombinant Protein

Product Code. 30208018

Brand: Invitrogen™ RP97299

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83531 (PA5-83531. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The cysteine and histidine-rich domain (CHORD)-containing protein (CHORDC1) is a member of a highly conserved protein family that contains the plant protein RAR1 and the mammalian protein melusin. In mammals, CHORDC1 is an ADP-dependent HSP90-interacting protein, and this interaction is dependent on the ability of HSP90 to bind nucleotides. Recent experiments indicate that CHORDC1 mRNA is diurnally regulated in mouse hypothalamus, and that this regulation alters during development, suggesting that CHORDC1 may play a role in circadian mechanisms in the mammalian brain.

Specifications

• Accession Number: Q9UHD1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26973
• Name: Human CHORDC1 (aa 37-106) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110001O09Rik; AA409036; chord domain-containing protein 1; CHORDC1; chordc1b; CHORD-containing protein 1; CHP1; CHP-1; cysteine and histidine rich domain containing 1; cysteine and histidine-rich domain (CHORD) containing 1; cysteine and histidine-rich domain (CHORD) containing 1 b; cysteine and histidine-rich domain (CHORD)-containing 1; cysteine and histidine-rich domain (CHORD)-containing, zinc binding protein 1; cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1; cysteine and histidine-rich domain-containing protein 1; MGC137302 protein; morgana; Protein morgana; zgc:63894
• Common Name: CHORDC1
• Gene Symbol: CHORDC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining