Invitrogen™ Human CHOP (aa 3-78) Control Fragment Recombinant Protein

Product Code. 30195885

Brand: Invitrogen™ RP103961

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111468 (PA5-111468. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GADD153 is a small nuclear protein that is capable of dimerizing with transcription factors C/EBP alpha and beta. Once dimerized, this complex inhibits the normal binding and function of C/EBP to classical binding sites. Inversely, the C/EBP GADD153 dimer gains binding activity to other non classical C/EBP stress related targets. Under normal cellular conditions this protein is not expressed in detectable levels, but is highly unregulated during times of cellular/ER stress. Examples of GADD153 inducing stress include: treatment with tunicamycin, nutrient starvation and reducing agents that interfere with the calcium flux across the ER membrane.

Specifications

• Accession Number: P35638
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1649
• Name: Human CHOP (aa 3-78) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C/EBP homologous protein; C/EBP homoologous protein 10; C/EBP zeta; C/EBP-homologous protein; C/EBP-homologous protein 10; CCAAT/enhancer-binding protein homologous protein; CEBPZ; CHOP; CHOP10; CHOP-10; Ddit3; DDIT-3; ddit3.L; DNA damage inducible transcript 3; DNA damage inducible transcript 3 L homeolog; DNA damage-inducible transcript 3 protein; DNA-damage inducible transcript 3; DNA-damage-inducible transcript 3; GADD153; growth arrest and DNA damage-inducible; growth arrest and DNA damage-inducible protein GADD153; Growth arrest and DNA-damage-inducible protein GADD153; MGC4154; transcription factor GADD153; Xchop; XELAEV_18013440mg
• Common Name: CHOP
• Gene Symbol: DDIT3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining