Invitrogen™ Human Chondrolectin (aa 32-85) Control Fragment Recombinant Protein

Product Code. 30196047

Brand: Invitrogen™ RP108944

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathogens. This protein localizes predominantly to the perinuclear region. Several transcript variants encoding a few different isoforms have been found for this gene.

Specifications

• Accession Number: Q9H9P2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 140578
• Name: Human Chondrolectin (aa 32-85) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110074E07Rik; C21orf68; CHODL; Chondrolectin; FLJ12627; LOW QUALITY PROTEIN: chondrolectin; MT75; PRED12; Transmembrane protein MT75; UNQ872/PRO1890
• Common Name: Chondrolectin
• Gene Symbol: CHODL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining