Invitrogen™ Human CHKA (aa 341-431) Control Fragment Recombinant Protein

Product Code. 30200733

Brand: Invitrogen™ RP91725

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54995 (PA5-54995. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. Choline kinase alpha is the initial enzyme in the sequence and may play a regulatory role. This protein also catalyzes the phosphorylation of ethanolamine.

Specifications

• Accession Number: P35790
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1119
• Name: Human CHKA (aa 341-431) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CHETK-alpha; CHK; CHKA; ChoK; Choline kinase alpha; choline kinase R; choline/ethanolamine kinase alpha; CK; CK/EK-alpha; CKI; Ckr; CK-R; EK; ethanolamine kinase; EtnK-alpha
• Common Name: CHKA
• Gene Symbol: CHKA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLWGLWSIVQAKIS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining