Invitrogen™ Human Chk1 (aa 180-309) Control Fragment Recombinant Protein

Product Code. 30206480

Brand: Invitrogen™ RP106065

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHEK1 (CHK1) is a serine/threonine protein kinase involved in preventing replication when DNA integrity is compromised. CHK1 is a key mediator in the DNA damage-induced checkpoint network. CHK1 is an evolutionarily conserved protein kinase that functions to ensure genomic integrity upon genotoxic stress. When the G2 or S checkpoint is abrogated by the inhibition of CHK1, p53-deficient cancer cells undergo mitotic catastrophe and eventually apoptosis, whereas normal cells are still arrested in the G1 phase. Thus, CHK1 inhibitors can preferentially potentiate the efficacy of DNA damaging agents in cancer cells, and Chk1 is an attractive therapeutic target for cancer treatment, especially since approximately 50% of all human cancers are p53-deficient.

Specifications

• Accession Number: O14757
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1111
• Name: Human Chk1 (aa 180-309) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C85740; Cell cycle checkpoint kinase; checkpoint kinase 1; checkpoint kinase 1 homolog; checkpoint kinase-1; Checkpoint, S. pombe, homolog of, 1; CHEK1; CHK1; CHK1 checkpoint homolog; Chk1-S; homolog of Chk1-S; HRD1 Protein; rad27; rad27 homolog; serine/threonine protein kinase CHK1; serine/threonine-protein kinase Chk1; Synoviolin; YBR1742; YBR274W
• Common Name: Chk1
• Gene Symbol: Chek1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining