missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196748

Invitrogen™ Human CHIA (aa 234-305) Control Fragment Recombinant Protein

Product Code. 30196748
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196748

Brand: Invitrogen™ RP94208

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63681 (PA5-63681. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHIA degrades chitin and chitotriose. May participate in the defense against nematodes and other pathogens. There are 3 named isoforms produced by alternative splicing. CHIA is induced via a T helper-2 (Th2)-specific, interleukin-13-mediated pathway in epithelial cells and macrophages. CHIA may be an important mediator of IL13-induced responses in Th2-dominated disorders such as asthma. CHIA hydrolysis N-acetyl-beta-D-glucosaminide 1,4-beta-linkages in chitin and chitodextrins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BZP6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27159
Name Human CHIA (aa 234-305) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2200003E03Rik; acidic chitinase; acidic mammalian chitinase; AMCASE; Chia; Chia1; CHIT2; chitinase, acidic; chitinase, acidic 1; eosinophil chemotactic cytokine; lung-specific protein TSA1902; small acid mammalian chitinase; TSA1902; YNL
Common Name CHIA
Gene Symbol CHIA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.