Invitrogen™ Human CHI3L2 (aa 51-177) Control Fragment Recombinant Protein

Product Code. 30193700

Brand: Invitrogen™ RP88572

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52144 (PA5-52144. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHI3L2 may bind glycan structure with high affinity, but not heparin. Has no chitotriosidase activity.

Specifications

• Accession Number: Q15782
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1117
• Name: Human CHI3L2 (aa 51-177) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CHI3L2; CHIL2; chitinase 3 like 2; chitinase 3-like 2; chitinase-3-like protein 2; Chondrocyte protein 39; YKL39; YKL-39
• Common Name: CHI3L2
• Gene Symbol: CHI3L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining