Invitrogen™ Human CHERP (aa 631-737) Control Fragment Recombinant Protein

Product Code. 30197104

Brand: Invitrogen™ RP89198

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62228 (PA5-62228. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHERP is involved in calcium homeostasis, growth and proliferation.

Specifications

• Accession Number: Q8IWX8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10523
• Name: Human CHERP (aa 631-737) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730408I11Rik; Calcium homeostasis endoplasmic reticulum protein; CHERP; D8Wsu96e; DAN16; DAN26; ERPROT 213-21; ERPROT213-21; fc83d01; ik:tdsubc_2h12; protein with polyglutamine repeat; Scaf6; spliceosome associated factor; SCAF6; SRA1; SR-related CTD associated factor 6; SR-related CTD-associated factor 6; tdsubc_2h12; Unknown (protein for IMAGE:8005617); wu:fc83d01; xx:tdsubc_2h12; zgc:55518
• Common Name: CHERP
• Gene Symbol: CHERP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPHINHDDPSLVPNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining