Invitrogen™ Human CHD5 (aa 1574-1659) Control Fragment Recombinant Protein

Product Code. 30209977

Brand: Invitrogen™ RP103713

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63133 (PA5-63133. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHD5 (Chromodomain helicase DNA binding protein 5) is a member of the SNF2/RAD54 helicase family of chromatin remodeling and DNA-binding proteins (CDH proteins). Heavily expressed in both fetal and adult brain, CHD5 plays a role in nervous system development and acts as a tumor suppressor via the Arf/p53 pathway. CHD5, along with other chromo-domain proteins, forms remodeling complexes, such as NuRD, that promote normal neuroblast maturation and are thought to prevent overexpression of neuronal cells. Errors in these chromatin remodeling complexes can leave the cell in a perpetual state of growth, preventing differentiation and leading to tumor formation. Due to the importance of the CHD proteins in proper brain development, deletions in the gene encoding CHD5 are commonly found in neuroblastomas, suggesting that CHD5 deficiency may lead to malignant cell transformation and metastasis.

Specifications

• Accession Number: Q8TDI0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26038
• Name: Human CHD5 (aa 1574-1659) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930532L22Rik; ATP-dependent helicase CHD5; AW060752; B230399N07Rik; CHD5; CHD-5; chromodomain helicase DNA binding protein 5; chromodomain-helicase-DNA-binding protein 5; KIAA0444
• Common Name: CHD5
• Gene Symbol: CHD5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHESPASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining