Invitrogen™ Human CHCHD1 (aa 1-59) Control Fragment Recombinant Protein

Artikelnummer. 30194631

missing translation for 'mfr': Invitrogen™ RP97165

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58635 (PA5-58635. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHCHD1 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1) is a Protein Coding gene. Among its related pathways are Mitochondrial translation and Organelle biogenesis and maintenance.

Spezifikation

• Accession Number: Q96BP2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 118487
• Name: Human CHCHD1 (aa 1-59) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110001O19Rik; 2400010G13Rik; 28 S ribosomal protein S37, mitochondrial; C10orf34; C2360; CHCHD1; coiled-coil-helix-coiled-coil-helix domain containing 1; coiled-coil-helix-coiled-coil-helix domain-containing protein 1; Mitochondrial small ribosomal subunit protein mS37; MRPS37; MRP-S37; Nuclear protein C2360; similar to coiled-coil-helix-coiled-coil-helix domain containing 1
• Common Name: CHCHD1
• Gene Symbol: Chchd1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining