Invitrogen™ Human CHAMP1 (aa 514-646) Control Fragment Recombinant Protein

Product Code. 30196060

missing translation for 'mfr': Invitrogen™ RP89500

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52624 (PA5-52624. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for proper alignment of chromosomes at metaphase and their accurate segregation during mitosis. Involved in the maintenance of spindle microtubules attachment to the kinetochore during sister chromatid biorientation. May recruit CENPE and CENPF to the kinetochore.

Specifications

• Accession Number: Q96JM3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 283489
• Name: Human CHAMP1 (aa 514-646) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA675043; AI116001; C13orf8; CAMP; CHAMP; Champ1; chromosome alignment maintaining phosphoprotein 1; chromosome alignment-maintaining phosphoprotein 1; D8Ertd457e; D8Ertd569e; Kiaa1802; mKIAA1802; MRD40; RGD1311283; Zfp828; zinc finger protein 828; ZNF828
• Common Name: CHAMP1
• Gene Symbol: CHAMP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IWKPVLSIDTEPRKPALFPEPAKTAPPASPEARKRALFPEPRKHALFPELPKSALFSESQKAVELGDELQIDAIDDQKCDILVQEELLASPKKLLEDTLFPSSKKLKKDNQESSDAELSSSEYIKTDLDAMDI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining