Invitrogen™ Human CGRRF1 (aa 187-330) Control Fragment Recombinant Protein

Product Code. 30205106

Brand: Invitrogen™ RP89080

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51779 (PA5-51779. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CGRRF1 is able to inhibit growth in several cell lines.

Specifications

• Accession Number: Q99675
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10668
• Name: Human CGRRF1 (aa 187-330) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110038G02Rik; 1810009H17Rik; cell growth regulator with ring finger domain 1; cell growth regulator with RING finger domain protein 1; Cell growth regulatory gene 19 protein; cell growth regulatory with ring finger domain; CGR19; Cgrrf1; RING finger protein 197; RNF197
• Common Name: CGRRF1
• Gene Symbol: CGRRF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDKDKPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining